PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9032_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 350aa    MW: 39820.2 Da    PI: 4.9405
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9032_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.5e-092933272155
                                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                          k +yp+++++  LA+++gL+++q+ +WF N+R ++
  cra_locus_9032_iso_1_len_1501_ver_3 293 KWPYPTEADKISLAESTGLDQKQINNWFINQRKRH 327
                                          679*****************************885 PP

2ELK31.93e-11247268122
                                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                          ELK++LlrKY+ +++sLk EFs
  cra_locus_9032_iso_1_len_1501_ver_3 247 ELKERLLRKYGNHISSLKLEFS 268
                                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-13115157IPR005540KNOX1
PfamPF037905.6E-16116145IPR005540KNOX1
SMARTSM012564.8E-24166217IPR005541KNOX2
PfamPF037911.6E-22170215IPR005541KNOX2
PROSITE profilePS5121310.458247267IPR005539ELK domain
SMARTSM011885.8E-6247268IPR005539ELK domain
PfamPF037892.4E-7247268IPR005539ELK domain
PROSITE profilePS5007112.811267330IPR001356Homeobox domain
SuperFamilySSF466891.07E-19268342IPR009057Homeodomain-like
SMARTSM003891.8E-13269334IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-28272331IPR009057Homeodomain-like
CDDcd000862.90E-13279331No hitNo description
PfamPF059201.0E-17287326IPR008422Homeobox KN domain
PROSITE patternPS000270305328IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDEMYGLHTT GDYADKALMS PENLMMIMPS DYDSYHGGGG LINSSSSGGG ADHHHNRIPM  60
FGSDDNIGTG GFQCSGISET ASITPHEIHH HHQRKIIYNN EDYEEHEDHH EDSCSAIKAK  120
IASHPSYPKL IDAYIDCQKV GAPPEKLLFW MRSEEKNEFC RQDVGSTTCL GADPELDEFM  180
ETYCDILVKY KSDLSRPFDE ARTFLNNIEL QLGTLSRDDG GVSSEDDFSG GETEVQDDGQ  240
MKGEDSELKE RLLRKYGNHI SSLKLEFSKK KKKGKLPKEA RQILLEWWSV HYKWPYPTEA  300
DKISLAESTG LDQKQINNWF INQRKRHWKP SENMQLAVMD NLSGQFFPDE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263313.11e-138PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-125KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLD7TDJ71e-138D7TDJ7_VITVI; Putative uncharacterized protein
STRINGVIT_01s0127g00210.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480